No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00004647-M01 |
| Product name: | MYO7A monoclonal antibody (M01), clone 1D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MYO7A. |
| Clone: | 1D3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4647 |
| Gene name: | MYO7A |
| Gene alias: | DFNA11|DFNB2|MYOVIIA|MYU7A|NSRD2|USH1B |
| Gene description: | myosin VIIA |
| Genbank accession: | NM_000260 |
| Immunogen: | MYO7A (NP_000251, 2118 a.a. ~ 2213 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS |
| Protein accession: | NP_000251 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged MYO7A is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |