View larger

MYO5A (Human) Recombinant Protein (Q01)

Reference:

Condition: New product

Data sheet of MYO5A (Human) Recombinant Protein (Q01)

Brand:	Abnova
Reference:	H00004644-Q01
Product name:	MYO5A (Human) Recombinant Protein (Q01)
Product description:	Human MYO5A partial ORF ( NP_000250.1, 1758 a.a. - 1853 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	4644
Gene name:	MYO5A
Gene alias:	GS1\|MYH12\|MYO5\|MYR12
Gene description:	myosin VA (heavy chain 12, myoxin)
Genbank accession:	NM_000259
Immunogen sequence/protein sequence:	KKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS
Protein accession:	NP_000250.1
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Myosin 5a regulates tumor migration and epithelial-mesenchymal transition in esophageal squamous cell carcinoma: utility as a prognostic factor.Sato N, Fujishima F, Nakamura Y, Aoyama Y, Onodera Y, Ozawa Y, Ito K, Ishida H, Kamei T, Watanabe M, Sasano H. Hum Pathol. 2018 Jun 10. [Epub ahead of print]