No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00004638-M01 |
Product name: | MYLK monoclonal antibody (M01), clone 1D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MYLK. |
Clone: | 1D1 |
Isotype: | IgG1 Kappa |
Gene id: | 4638 |
Gene name: | MYLK |
Gene alias: | DKFZp686I10125|FLJ12216|KRP|MLCK|MLCK1|MLCK108|MLCK210|MSTP083|MYLK1|smMLCK |
Gene description: | myosin light chain kinase |
Genbank accession: | NM_053025 |
Immunogen: | MYLK (NP_444253, 1710 a.a. ~ 1809 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKP |
Protein accession: | NP_444253 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MYLK expression in transfected 293T cell line by MYLK monoclonal antibody (M01), clone 1D1. Lane 1: MYLK transfected lysate(110.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |