No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00004637-A01 |
Product name: | MYL6 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MYL6. |
Gene id: | 4637 |
Gene name: | MYL6 |
Gene alias: | ESMLC|LC17-GI|LC17-NM|LC17A|LC17B|MLC1SM|MLC3NM|MLC3SM |
Gene description: | myosin, light chain 6, alkali, smooth muscle and non-muscle |
Genbank accession: | NM_021019 |
Immunogen: | MYL6 (NP_066299, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEG |
Protein accession: | NP_066299 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Identification and expression analysis of genes associated with bovine blastocyst formation.Goossens K, Van Soom A, Van Poucke M, Vandaele L, Vandesompele J, Van Zeveren A, Peelman LJ. BMC Dev Biol. 2007 Jun 8;7:64. |