MYL5 monoclonal antibody (M03), clone 3D12 View larger

MYL5 monoclonal antibody (M03), clone 3D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYL5 monoclonal antibody (M03), clone 3D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re

More info about MYL5 monoclonal antibody (M03), clone 3D12

Brand: Abnova
Reference: H00004636-M03
Product name: MYL5 monoclonal antibody (M03), clone 3D12
Product description: Mouse monoclonal antibody raised against a partial recombinant MYL5.
Clone: 3D12
Isotype: IgG1 Kappa
Gene id: 4636
Gene name: MYL5
Gene alias: -
Gene description: myosin, light chain 5, regulatory
Genbank accession: NM_002477
Immunogen: MYL5 (NP_002468, 4 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKL
Protein accession: NP_002468
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004636-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004636-M03-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged MYL5 is approximately 3ng/ml as a capture antibody.
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MYL5 monoclonal antibody (M03), clone 3D12 now

Add to cart