MYL5 monoclonal antibody (M01), clone 1C5 View larger

MYL5 monoclonal antibody (M01), clone 1C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYL5 monoclonal antibody (M01), clone 1C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about MYL5 monoclonal antibody (M01), clone 1C5

Brand: Abnova
Reference: H00004636-M01
Product name: MYL5 monoclonal antibody (M01), clone 1C5
Product description: Mouse monoclonal antibody raised against a full length recombinant MYL5.
Clone: 1C5
Isotype: IgG2a Kappa
Gene id: 4636
Gene name: MYL5
Gene alias: -
Gene description: myosin, light chain 5, regulatory
Genbank accession: BC040050
Immunogen: MYL5 (AAH40050.1, 1 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Protein accession: AAH40050.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004636-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.26 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004636-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged MYL5 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MYL5 monoclonal antibody (M01), clone 1C5 now

Add to cart