Brand: | Abnova |
Reference: | H00004635-M01 |
Product name: | MYL4 monoclonal antibody (M01), clone 1A11-C8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MYL4. |
Clone: | 1A11-C8 |
Isotype: | IgG1 Kappa |
Gene id: | 4635 |
Gene name: | MYL4 |
Gene alias: | ALC1|AMLC|GT1|PRO1957 |
Gene description: | myosin, light chain 4, alkali; atrial, embryonic |
Genbank accession: | BC030228 |
Immunogen: | MYL4 (AAH30228, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG |
Protein accession: | AAH30228 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (47.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged MYL4 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Embryonic Essential Myosin Light Chain Regulates Fetal Lung Development in Rats.Santos M, Moura RS, Gonzaga S, Nogueira-Silva C, Ohlmeier S, Correia-Pinto J. Am J Respir Cell Mol Biol. 2007 Sep;37(3):330-8. Epub 2007 May 31. |