MYH9 monoclonal antibody (M05), clone 1H6 View larger

MYH9 monoclonal antibody (M05), clone 1H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYH9 monoclonal antibody (M05), clone 1H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about MYH9 monoclonal antibody (M05), clone 1H6

Brand: Abnova
Reference: H00004627-M05
Product name: MYH9 monoclonal antibody (M05), clone 1H6
Product description: Mouse monoclonal antibody raised against a partial recombinant MYH9.
Clone: 1H6
Isotype: IgG1 Kappa
Gene id: 4627
Gene name: MYH9
Gene alias: DFNA17|EPSTS|FTNS|MGC104539|MHA|NMHC-II-A|NMMHCA
Gene description: myosin, heavy chain 9, non-muscle
Genbank accession: NM_002473.5
Immunogen: MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Protein accession: NP_002464.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004627-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004627-M05-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged MYH9 is approximately 0.03ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MYH9 monoclonal antibody (M05), clone 1H6 now

Add to cart