No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00004627-M04 |
| Product name: | MYH9 monoclonal antibody (M04), clone 4D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MYH9. |
| Clone: | 4D1 |
| Isotype: | IgG3 Kappa |
| Gene id: | 4627 |
| Gene name: | MYH9 |
| Gene alias: | DFNA17|EPSTS|FTNS|MGC104539|MHA|NMHC-II-A|NMMHCA |
| Gene description: | myosin, heavy chain 9, non-muscle |
| Genbank accession: | NM_002473.5 |
| Immunogen: | MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE |
| Protein accession: | NP_002464.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged MYH9 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |