Brand: | Abnova |
Reference: | H00004627-M03 |
Product name: | MYH9 monoclonal antibody (M03), clone 2B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MYH9. |
Clone: | 2B3 |
Isotype: | IgG2b Kappa |
Gene id: | 4627 |
Gene name: | MYH9 |
Gene alias: | DFNA17|EPSTS|FTNS|MGC104539|MHA|NMHC-II-A|NMMHCA |
Gene description: | myosin, heavy chain 9, non-muscle |
Genbank accession: | NM_002473.5 |
Immunogen: | MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE |
Protein accession: | NP_002464.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MYH9 is approximately 0.03ng/ml as a capture antibody. |
Applications: | WB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |