Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MYD88 MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Rabbit |
| Applications | WB-Ti,IF,WB-Tr,IP |
More info about MYD88 MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00004615-D01 |
| Product name: | MYD88 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human MYD88 protein. |
| Gene id: | 4615 |
| Gene name: | MYD88 |
| Gene alias: | MYD88D |
| Gene description: | myeloid differentiation primary response gene (88) |
| Genbank accession: | NM_002468 |
| Immunogen: | MYD88 (NP_002459.1, 1 a.a. ~ 296 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP |
| Protein accession: | NP_002459.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Western Blot analysis of MYD88 expression in transfected 293T cell line (H00004615-T03) by MYD88 MaxPab polyclonal antibody. Lane 1: MYD88 transfected lysate(33.20 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IF,WB-Tr,IP |
| Shipping condition: | Dry Ice |