View larger

MYD88 purified MaxPab mouse polyclonal antibody (B02P)

Reference:

Condition: New product

Data sheet of MYD88 purified MaxPab mouse polyclonal antibody (B02P)

Brand:	Abnova
Reference:	H00004615-B02P
Product name:	MYD88 purified MaxPab mouse polyclonal antibody (B02P)
Product description:	Mouse polyclonal antibody raised against a full-length human MYD88 protein.
Gene id:	4615
Gene name:	MYD88
Gene alias:	MYD88D
Gene description:	myeloid differentiation primary response gene (88)
Genbank accession:	NM_002468
Immunogen:	MYD88 (NP_002459.1, 1 a.a. ~ 296 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
Protein accession:	NP_002459.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of MYD88 expression in transfected 293T cell line (H00004615-T02) by MYD88 MaxPab polyclonal antibody. Lane 1: MYD88 transfected lysate(32.56 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ti,WB-Tr
Shipping condition:	Dry Ice