View larger

MYC (Human) Recombinant Protein (Q01)

Reference:

Condition: New product

Data sheet of MYC (Human) Recombinant Protein (Q01)

Brand:	Abnova
Reference:	H00004609-Q01
Product name:	MYC (Human) Recombinant Protein (Q01)
Product description:	Human MYC partial ORF ( NP_002458, 330 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	4609
Gene name:	MYC
Gene alias:	bHLHe39\|c-Myc
Gene description:	v-myc myelocytomatosis viral oncogene homolog (avian)
Genbank accession:	NM_002467
Immunogen sequence/protein sequence:	VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Protein accession:	NP_002458
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	CDK5-mediated phosphorylation of c-MYC on SER62 is essential in transcriptional activation of cyclin B1 by cyclin G1.Seo HR, Kim J, Bae S, Soh JW, Lee YS. J Biol Chem. 2008 Jun 6;283(23):15601-15610. Epub 2008 Apr 11.