Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MYC monoclonal antibody (M02), clone 1G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IF-CTC |
More info about MYC monoclonal antibody (M02), clone 1G7
| Brand: | Abnova |
| Reference: | H00004609-M02 |
| Product name: | MYC monoclonal antibody (M02), clone 1G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MYC. |
| Clone: | 1G7 |
| Isotype: | IgG3 Kappa |
| Gene id: | 4609 |
| Gene name: | MYC |
| Gene alias: | bHLHe39|c-Myc |
| Gene description: | v-myc myelocytomatosis viral oncogene homolog (avian) |
| Genbank accession: | NM_002467 |
| Immunogen: | MYC (NP_002458, 330 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA |
| Protein accession: | NP_002458 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MYC on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IF-CTC |
| Shipping condition: | Dry Ice |
| Publications: | From midbody protein-protein interaction network construction to novel regulators in cytokinesis.Chen TC, Lee SA, Hong TM, Shih JY, Lai JM, Chiou HY, Yang SC, Chan CH, Kao CY, Yang PC, Huang CY. J Proteome Res. 2009 Nov;8(11):4943-53. |