| Brand: | Abnova |
| Reference: | H00004598-A01 |
| Product name: | MVK polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MVK. |
| Gene id: | 4598 |
| Gene name: | MVK |
| Gene alias: | FLJ96772|LRBP|MK|MVLK |
| Gene description: | mevalonate kinase |
| Genbank accession: | BC016140 |
| Immunogen: | MVK (AAH16140, 297 a.a. ~ 396 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LIDMNQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQPEVEATKQALTSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL |
| Protein accession: | AAH16140 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | MVK polyclonal antibody (A01), Lot # 051116JC01 Western Blot analysis of MVK expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |