| Brand: | Abnova |
| Reference: | H00004585-M07 |
| Product name: | MUC4 monoclonal antibody (M07), clone 5B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MUC4. |
| Clone: | 5B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4585 |
| Gene name: | MUC4 |
| Gene alias: | HSA276359 |
| Gene description: | mucin 4, cell surface associated |
| Genbank accession: | NM_004532 |
| Immunogen: | MUC4 (NP_004523, 79 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GVSLFPYGADAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPNPLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHS |
| Protein accession: | NP_004523 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MUC4 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Effect of a Semi-Purified Oligosaccharide-Enriched Fraction from Caprine Milk on Barrier Integrity and Mucin Production of Co-Culture Models of the Small and Large Intestinal Epithelium.Barnett AM, Roy NC, McNabb WC, Cookson AL. Nutrients. 2016 May 6. [Epub ahead of print] |