Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MTNR1A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MTNR1A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004543-A01 |
| Product name: | MTNR1A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MTNR1A. |
| Gene id: | 4543 |
| Gene name: | MTNR1A |
| Gene alias: | MEL-1A-R|MT1 |
| Gene description: | melatonin receptor 1A |
| Genbank accession: | NM_005958 |
| Immunogen: | MTNR1A (NP_005949, 296 a.a. ~ 350 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV |
| Protein accession: | NP_005949 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.16 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Expression and cellular localizaion of melatonin-synthesizing enzymes in rat and human salivary glands.Shimozuma M, Tokuyama R, Tatehara S, Umeki H, Ide S, Mishima K, Saito I, Satomura K. Histochem Cell Biol. 2011 Apr;135(4):389-96. Epub 2011 Mar 10. |