Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ND1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ND1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004535-A01 |
| Product name: | ND1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ND1. |
| Gene id: | 4535 |
| Gene name: | ND1 |
| Gene alias: | MTND1 |
| Gene description: | NADH dehydrogenase, subunit 1 (complex I) |
| Genbank accession: | NC_012920.1 |
| Immunogen: | ND1 (YP_003024026, 21 a.a. ~ 71 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MLTERKILGYIQLRKGPNVVGPYGLLQPFADAIKLFTKEPLKPATSTITLY |
| Protein accession: | YP_003024026 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ND1 polyclonal antibody (A01), Lot # NIH48060209QCS1 Western Blot analysis of ND1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Exercise Intolerance and Myoglobinuria Associated with a Novel Maternally Inherited MT-ND1 Mutation.Rafiq J, Duno M, Ostergaard E, Ravn K, Vissing CR, Wibrand F, Vissing J. JIMD Rep. 2015 Jun 25. [Epub ahead of print] |