| Brand: | Abnova |
| Reference: | H00004515-M05 |
| Product name: | MTCP1 monoclonal antibody (M05), clone 1G12 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MTCP1. |
| Clone: | 1G12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4515 |
| Gene name: | MTCP1 |
| Gene alias: | C6.1B|P13MTCP1 |
| Gene description: | mature T-cell proliferation 1 |
| Genbank accession: | BC002600 |
| Immunogen: | MTCP1 (AAH02600, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK |
| Protein accession: | AAH02600 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MTCP1 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |