| Brand: | Abnova |
| Reference: | H00004486-M10 |
| Product name: | MST1R monoclonal antibody (M10), clone 3H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MST1R. |
| Clone: | 3H2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4486 |
| Gene name: | MST1R |
| Gene alias: | CD136|CDw136|PTK8|RON |
| Gene description: | macrophage stimulating 1 receptor (c-met-related tyrosine kinase) |
| Genbank accession: | NM_002447 |
| Immunogen: | MST1R (NP_002438, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL |
| Protein accession: | NP_002438 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MST1R is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |