Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MST1 monoclonal antibody (M04), clone 3B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about MST1 monoclonal antibody (M04), clone 3B5
| Brand: | Abnova |
| Reference: | H00004485-M04 |
| Product name: | MST1 monoclonal antibody (M04), clone 3B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MST1. |
| Clone: | 3B5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4485 |
| Gene name: | MST1 |
| Gene alias: | D3F15S2|DNF15S2|HGFL|MSP|NF15S2 |
| Gene description: | macrophage stimulating 1 (hepatocyte growth factor-like) |
| Genbank accession: | BC048330 |
| Immunogen: | MST1 (AAH48330, 19 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRG |
| Protein accession: | AAH48330 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MST1 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Novel Treatment of Metabolic Diseases.Maedler K, Ardestani A. United States Patent Application. 2016 Mar 24. 20160083733A1 |