Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MSMB monoclonal antibody (M08), clone 3B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about MSMB monoclonal antibody (M08), clone 3B11
| Brand: | Abnova |
| Reference: | H00004477-M08 |
| Product name: | MSMB monoclonal antibody (M08), clone 3B11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MSMB. |
| Clone: | 3B11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4477 |
| Gene name: | MSMB |
| Gene alias: | HPC13|IGBF|MSP|MSPB|PN44|PRPS|PSP|PSP-94|PSP57|PSP94 |
| Gene description: | microseminoprotein, beta- |
| Genbank accession: | BC005257 |
| Immunogen: | MSMB (AAH05257.1, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII |
| Protein accession: | AAH05257.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MSMB is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Expression patterns of candidate susceptibility genes HNF1β and CtBP2 in prostate cancer: Association with tumor progression.Debiais-Delpech C, Godet J, Pedretti N, Bernard FX, Irani J, Cathelineau X, Cussenot O, Fromont G Urol Oncol. 2013 Dec 11. pii: S1078-1439(13)00349-9. doi: 10.1016/j.urolonc.2013.09.006. |