| Brand: | Abnova |
| Reference: | H00004436-A01 |
| Product name: | MSH2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MSH2. |
| Gene id: | 4436 |
| Gene name: | MSH2 |
| Gene alias: | COCA1|FCC1|HNPCC|HNPCC1|LCFS2 |
| Gene description: | mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) |
| Genbank accession: | BC021566 |
| Immunogen: | MSH2 (AAH21566, 835 a.a. ~ 934 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT |
| Protein accession: | AAH21566 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MSH2 polyclonal antibody (A01), Lot # 050727JC01 Western Blot analysis of MSH2 expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |