| Brand: | Abnova |
| Reference: | H00004435-D01 |
| Product name: | CITED1 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CITED1 protein. |
| Gene id: | 4435 |
| Gene name: | CITED1 |
| Gene alias: | MSG1 |
| Gene description: | Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 |
| Genbank accession: | NM_004143.2 |
| Immunogen: | CITED1 (NP_004134.1, 1 a.a. ~ 193 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC |
| Protein accession: | NP_004134.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of CITED1 transfected lysate using anti-CITED1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CITED1 monoclonal antibody (M01), clone 6G8 (H00004435-M01). |
| Applications: | IP |
| Shipping condition: | Dry Ice |