Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MRC1 monoclonal antibody (M02), clone 5C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
More info about MRC1 monoclonal antibody (M02), clone 5C11
| Brand: | Abnova |
| Reference: | H00004360-M02 |
| Product name: | MRC1 monoclonal antibody (M02), clone 5C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MRC1. |
| Clone: | 5C11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4360 |
| Gene name: | MRC1 |
| Gene alias: | CD206|CLEC13D|MMR |
| Gene description: | mannose receptor, C type 1 |
| Genbank accession: | NM_002438 |
| Immunogen: | MRC1 (NP_002429, 22 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY |
| Protein accession: | NP_002429 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MRC1 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Macrophage polarisation changes within the time between diagnostic biopsy and tumour resection in oral squamous cell carcinomas-an immunohistochemical study.Weber M, Moebius P, Buttner-Herold M, Amann K, Preidl R, Neukam FW, Wehrhan F. Br J Cancer. 2015 Jun 25. [Epub ahead of print] |