Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MPP1 monoclonal antibody (M03), clone 2E5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about MPP1 monoclonal antibody (M03), clone 2E5
| Brand: | Abnova |
| Reference: | H00004354-M03 |
| Product name: | MPP1 monoclonal antibody (M03), clone 2E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MPP1. |
| Clone: | 2E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4354 |
| Gene name: | MPP1 |
| Gene alias: | AAG12|DXS552|DXS552E|EMP55|MRG1|PEMP |
| Gene description: | membrane protein, palmitoylated 1, 55kDa |
| Genbank accession: | NM_002436 |
| Immunogen: | MPP1 (NP_002427, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVAR |
| Protein accession: | NP_002427 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MPP1 monoclonal antibody (M03), clone 2E5. Western Blot analysis of MPP1 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |