Brand: | Abnova |
Reference: | H00004353-M01 |
Product name: | MPO monoclonal antibody (M01), clone 3E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MPO. |
Clone: | 3E11 |
Isotype: | IgG2b Kappa |
Gene id: | 4353 |
Gene name: | MPO |
Gene alias: | - |
Gene description: | myeloperoxidase |
Genbank accession: | NM_000250 |
Immunogen: | MPO (NP_000241, 646 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS |
Protein accession: | NP_000241 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | MPO monoclonal antibody (M01), clone 3E11. Western Blot analysis of MPO expression in Jurkat. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |