| Brand: | Abnova |
| Reference: | H00004350-M08 |
| Product name: | MPG monoclonal antibody (M08), clone 4B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MPG. |
| Clone: | 4B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4350 |
| Gene name: | MPG |
| Gene alias: | AAG|APNG|CRA36.1|MDG|Mid1|PIG11|PIG16|anpg |
| Gene description: | N-methylpurine-DNA glycosylase |
| Genbank accession: | BC014991 |
| Immunogen: | MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA |
| Protein accession: | AAH14991 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MPG monoclonal antibody (M08), clone 4B12 Western Blot analysis of MPG expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |