Brand: | Abnova |
Reference: | H00004350-M06 |
Product name: | MPG monoclonal antibody (M06), clone 2D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MPG. |
Clone: | 2D2 |
Isotype: | IgG2a Kappa |
Gene id: | 4350 |
Gene name: | MPG |
Gene alias: | AAG|APNG|CRA36.1|MDG|Mid1|PIG11|PIG16|anpg |
Gene description: | N-methylpurine-DNA glycosylase |
Genbank accession: | BC014991 |
Immunogen: | MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA |
Protein accession: | AAH14991 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MPG monoclonal antibody (M06), clone 2D2 Western Blot analysis of MPG expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |