| Brand: | Abnova |
| Reference: | H00004322-M07 |
| Product name: | MMP13 monoclonal antibody (M07), clone 3B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MMP13. |
| Clone: | 3B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4322 |
| Gene name: | MMP13 |
| Gene alias: | CLG3 |
| Gene description: | matrix metallopeptidase 13 (collagenase 3) |
| Genbank accession: | NM_002427 |
| Immunogen: | MMP13 (NP_002418, 362 a.a. ~ 471 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC |
| Protein accession: | NP_002418 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of MMP13 over-expressed 293 cell line, cotransfected with MMP13 Validated Chimera RNAi ( Cat # H00004322-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MMP13 monoclonal antibody (M07), clone 3B11 (Cat # H00004322-M07 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
| Shipping condition: | Dry Ice |