| Brand: | Abnova |
| Reference: | H00004312-D01 |
| Product name: | MMP1 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human MMP1 protein. |
| Gene id: | 4312 |
| Gene name: | MMP1 |
| Gene alias: | CLG|CLGN |
| Gene description: | matrix metallopeptidase 1 (interstitial collagenase) |
| Genbank accession: | NM_002421 |
| Immunogen: | MMP1 (NP_002412.1, 1 a.a. ~ 469 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |
| Protein accession: | NP_002412.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MMP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of MMP1 expression in human pancreas. |
| Applications: | WB-Ti,IHC-P,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | The effect of dehydroglyasperin C on UVB-mediated MMPs expression in human HaCaT cells.Xuan SH, Park YM, Ha JH, Jeong YJ, Park SN. Pharmacol Rep. 2017 Dec;69(6):1224-1231. doi: 10.1016/j.pharep.2017.05.012. Epub 2017 May 31. |