| Brand: | Abnova |
| Reference: | H00004297-A01 |
| Product name: | MLL polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MLL. |
| Gene id: | 4297 |
| Gene name: | MLL |
| Gene alias: | ALL-1|CXXC7|FLJ11783|HRX|HTRX1|KMT2A|MLL/GAS7|MLL1A|TET1-MLL|TRX1 |
| Gene description: | myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila) |
| Genbank accession: | NM_005933 |
| Immunogen: | MLL (NP_005924, 3561 a.a. ~ 3670 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLV |
| Protein accession: | NP_005924 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |