| Brand: | Abnova |
| Reference: | H00004283-M06 |
| Product name: | CXCL9 monoclonal antibody (M06), clone 1F5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CXCL9. |
| Clone: | 1F5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4283 |
| Gene name: | CXCL9 |
| Gene alias: | CMK|Humig|MIG|SCYB9|crg-10 |
| Gene description: | chemokine (C-X-C motif) ligand 9 |
| Genbank accession: | BC063122 |
| Immunogen: | CXCL9 (AAH63122, 23 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
| Protein accession: | AAH63122 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CXCL9 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |