CXCL9 purified MaxPab mouse polyclonal antibody (B02P) View larger

CXCL9 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CXCL9 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CXCL9 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00004283-B02P
Product name: CXCL9 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human CXCL9 protein.
Gene id: 4283
Gene name: CXCL9
Gene alias: CMK|Humig|MIG|SCYB9|crg-10
Gene description: chemokine (C-X-C motif) ligand 9
Genbank accession: BC063122
Immunogen: CXCL9 (AAH63122, 23 a.a. ~ 125 a.a) full-length human protein.
Immunogen sequence/protein sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Protein accession: AAH63122
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004283-B02P-13-15-1.jpg
Application image note: Western Blot analysis of CXCL9 expression in transfected 293T cell line (H00004283-T04) by CXCL9 MaxPab polyclonal antibody.

Lane 1: CXCL9 transfected lysate(13.86 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CXCL9 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart