| Brand: | Abnova |
| Reference: | H00004282-M01 |
| Product name: | MIF monoclonal antibody (M01), clone 2A10-4D3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MIF. |
| Clone: | 2A10-4D3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4282 |
| Gene name: | MIF |
| Gene alias: | GIF|GLIF|MMIF |
| Gene description: | macrophage migration inhibitory factor (glycosylation-inhibiting factor) |
| Genbank accession: | BC000447 |
| Immunogen: | MIF (AAH00447.1, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Protein accession: | AAH00447.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.39 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MIF on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma tissue. [antibody concentration 1 ~ 10 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | An HLA-Presented Fragment of Macrophage Migration Inhibitory Factor Is a Therapeutic Target for Invasive Breast Cancer.Hawkins O, Verma B, Lightfoot S, Jain R, Rawat A, McNair S, Caseltine S, Mojsilovic A, Gupta P, Neethling F, Almanza O, Dooley W, Hildebrand W, Weidanz J. J Immunol. 2011 Apr 22. [Epub ahead of print] |