| Brand: | Abnova |
| Reference: | H00004267-M01 |
| Product name: | CD99 monoclonal antibody (M01), clone 3A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD99. |
| Clone: | 3A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4267 |
| Gene name: | CD99 |
| Gene alias: | MIC2|MIC2X|MIC2Y |
| Gene description: | CD99 molecule |
| Genbank accession: | BC003147 |
| Immunogen: | CD99 (AAH03147, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD |
| Protein accession: | AAH03147 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CD99 monoclonal antibody (M01), clone 3A10 Western Blot analysis of CD99 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Orbital infantile myofibroma: a case report and clinicopathologic review of 24 cases from the literature.Mynatt CJ, Feldman KA, Thompson LD. Head Neck Pathol. 2011 Sep;5(3):205-15. Epub 2011 Apr 22. |