| Brand: | Abnova |
| Reference: | H00004259-A01 |
| Product name: | MGST3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MGST3. |
| Gene id: | 4259 |
| Gene name: | MGST3 |
| Gene alias: | GST-III |
| Gene description: | microsomal glutathione S-transferase 3 |
| Genbank accession: | NM_004528 |
| Immunogen: | MGST3 (NP_004519, 28 a.a. ~ 84 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPR |
| Protein accession: | NP_004519 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.38 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Sodium nitroprusside decreased leukotriene C4 generation by inhibiting leukotriene C4 synthase expression and activity in hepatic ischemia-reperfusion injured rats.Yang SL, Lou YJ. Biochem Pharmacol. 2007 Mar 1;73(5):724-35. Epub 2006 Nov 18. |