Brand: | Abnova |
Reference: | H00004254-M04 |
Product name: | KITLG monoclonal antibody (M04), clone 2A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KITLG. |
Clone: | 2A10 |
Isotype: | IgG2a Kappa |
Gene id: | 4254 |
Gene name: | KITLG |
Gene alias: | DKFZp686F2250|KL-1|Kitl|MGF|SCF|SF|SHEP7 |
Gene description: | KIT ligand |
Genbank accession: | NM_003994 |
Immunogen: | KITLG (NP_003985, 26 a.a. ~ 245 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKGKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV |
Protein accession: | NP_003985 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |