Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 610,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 610,00 €
Data sheet of KITLG monoclonal antibody (M04), clone 2A10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about KITLG monoclonal antibody (M04), clone 2A10
| Brand: | Abnova |
| Reference: | H00004254-M04 |
| Product name: | KITLG monoclonal antibody (M04), clone 2A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KITLG. |
| Clone: | 2A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4254 |
| Gene name: | KITLG |
| Gene alias: | DKFZp686F2250|KL-1|Kitl|MGF|SCF|SF|SHEP7 |
| Gene description: | KIT ligand |
| Genbank accession: | NM_003994 |
| Immunogen: | KITLG (NP_003985, 26 a.a. ~ 245 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKGKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV |
| Protein accession: | NP_003985 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |