KITLG monoclonal antibody (M01), clone 3E10 View larger

KITLG monoclonal antibody (M01), clone 3E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KITLG monoclonal antibody (M01), clone 3E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about KITLG monoclonal antibody (M01), clone 3E10

Brand: Abnova
Reference: H00004254-M01
Product name: KITLG monoclonal antibody (M01), clone 3E10
Product description: Mouse monoclonal antibody raised against a partial recombinant KITLG.
Clone: 3E10
Isotype: IgG1 Kappa
Gene id: 4254
Gene name: KITLG
Gene alias: DKFZp686F2250|KL-1|Kitl|MGF|SCF|SF|SHEP7
Gene description: KIT ligand
Genbank accession: NM_000899
Immunogen: KITLG (NP_000890, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLF
Protein accession: NP_000890
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004254-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged KITLG is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy KITLG monoclonal antibody (M01), clone 3E10 now

Add to cart