Cart 3 Product Products 962,04 € (empty)
No products
To be determined Shipping
962,04 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 962,04 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 962,04 €
Data sheet of KITLG monoclonal antibody (M01), clone 3E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about KITLG monoclonal antibody (M01), clone 3E10
| Brand: | Abnova |
| Reference: | H00004254-M01 |
| Product name: | KITLG monoclonal antibody (M01), clone 3E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KITLG. |
| Clone: | 3E10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4254 |
| Gene name: | KITLG |
| Gene alias: | DKFZp686F2250|KL-1|Kitl|MGF|SCF|SF|SHEP7 |
| Gene description: | KIT ligand |
| Genbank accession: | NM_000899 |
| Immunogen: | KITLG (NP_000890, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLF |
| Protein accession: | NP_000890 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged KITLG is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |