SCGB2A2 monoclonal antibody (M08), clone 3A4 View larger

SCGB2A2 monoclonal antibody (M08), clone 3A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCGB2A2 monoclonal antibody (M08), clone 3A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SCGB2A2 monoclonal antibody (M08), clone 3A4

Brand: Abnova
Reference: H00004250-M08
Product name: SCGB2A2 monoclonal antibody (M08), clone 3A4
Product description: Mouse monoclonal antibody raised against a full-length recombinant SCGB2A2.
Clone: 3A4
Isotype: IgG2a Kappa
Gene id: 4250
Gene name: SCGB2A2
Gene alias: MGB1|MGC71974|UGB2
Gene description: secretoglobin, family 2A, member 2
Genbank accession: NM_002411.1
Immunogen: SCGB2A2 (NP_002402.1, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Protein accession: NP_002402.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004250-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004250-M08-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SCGB2A2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SCGB2A2 monoclonal antibody (M08), clone 3A4 now

Add to cart