| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00004248-M02 |
| Product name: | MGAT3 monoclonal antibody (M02), clone 1C9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MGAT3. |
| Clone: | 1C9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4248 |
| Gene name: | MGAT3 |
| Gene alias: | FLJ43371|GNT-III|GNT3|MGC141943|MGC142278 |
| Gene description: | mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase |
| Genbank accession: | NM_002409 |
| Immunogen: | MGAT3 (NP_002400, 430 a.a. ~ 531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV |
| Protein accession: | NP_002400 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of MGAT3 expression in transfected 293T cell line by MGAT3 monoclonal antibody (M02), clone 1C9. Lane 1: MGAT3 transfected lysate (Predicted MW: 61.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |