Cart 8 Product Products 3 241,42 € (empty)
No products
To be determined Shipping
3 241,42 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 241,42 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 241,42 €
Data sheet of MGAT1 monoclonal antibody (M08A), clone 2G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about MGAT1 monoclonal antibody (M08A), clone 2G4
| Brand: | Abnova |
| Reference: | H00004245-M08A |
| Product name: | MGAT1 monoclonal antibody (M08A), clone 2G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MGAT1. |
| Clone: | 2G4 |
| Isotype: | IgM Kappa |
| Gene id: | 4245 |
| Gene name: | MGAT1 |
| Gene alias: | GLCNAC-TI|GLCT1|GLYT1|GNT-1|GNT-I|MGAT |
| Gene description: | mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase |
| Genbank accession: | NM_002406 |
| Immunogen: | MGAT1 (NP_002397, 348 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPLTWEGYDPSWN |
| Protein accession: | NP_002397 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |