MFAP3 monoclonal antibody (M01), clone 1C7 View larger

MFAP3 monoclonal antibody (M01), clone 1C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MFAP3 monoclonal antibody (M01), clone 1C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MFAP3 monoclonal antibody (M01), clone 1C7

Brand: Abnova
Reference: H00004238-M01
Product name: MFAP3 monoclonal antibody (M01), clone 1C7
Product description: Mouse monoclonal antibody raised against a partial recombinant MFAP3.
Clone: 1C7
Isotype: IgG2b Kappa
Gene id: 4238
Gene name: MFAP3
Gene alias: DKFZp586F0219
Gene description: microfibrillar-associated protein 3
Genbank accession: NM_005927
Immunogen: MFAP3 (NP_005918, 262 a.a. ~ 362 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGAYENCQL
Protein accession: NP_005918
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004238-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004238-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MFAP3 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MFAP3 monoclonal antibody (M01), clone 1C7 now

Add to cart