| Brand: | Abnova |
| Reference: | H00004222-M27 |
| Product name: | MEOX1 monoclonal antibody (M27), clone 4E10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MEOX1. |
| Clone: | 4E10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4222 |
| Gene name: | MEOX1 |
| Gene alias: | MOX1 |
| Gene description: | mesenchyme homeobox 1 |
| Genbank accession: | NM_004527 |
| Immunogen: | MEOX1 (NP_004518, 82 a.a. ~ 170 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSK* |
| Protein accession: | NP_004518 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.79 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to MEOX1 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |