Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAP3K5 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MAP3K5 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004217-A01 |
| Product name: | MAP3K5 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MAP3K5. |
| Gene id: | 4217 |
| Gene name: | MAP3K5 |
| Gene alias: | ASK1|MAPKKK5|MEKK5 |
| Gene description: | mitogen-activated protein kinase kinase kinase 5 |
| Genbank accession: | BC054503 |
| Immunogen: | MAP3K5 (AAH54503, 1231 a.a. ~ 1374 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT |
| Protein accession: | AAH54503 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Cell cloning-based transcriptome analysis in cyclin-dependent kinase-like 5 mutation patients with severe epileptic encephalopathy.Nectoux J, Fichou Y, Cagnard N, Bahi-Buisson N, Nusbaum P, Letourneur F, Chelly J, Bienvenu T. J Mol Med. 2010 Nov 24. [Epub ahead of print] |