| Brand: | Abnova |
| Reference: | H00004216-M08 |
| Product name: | MAP3K4 monoclonal antibody (M08), clone 4F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP3K4. |
| Clone: | 4F10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4216 |
| Gene name: | MAP3K4 |
| Gene alias: | FLJ42439|KIAA0213|MAPKKK4|MEKK4|MTK1|PRO0412 |
| Gene description: | mitogen-activated protein kinase kinase kinase 4 |
| Genbank accession: | NM_005922 |
| Immunogen: | MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS |
| Protein accession: | NP_005913 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MAP3K4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |