| Brand: | Abnova |
| Reference: | H00004211-A01 |
| Product name: | MEIS1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MEIS1. |
| Gene id: | 4211 |
| Gene name: | MEIS1 |
| Gene alias: | MGC43380 |
| Gene description: | Meis homeobox 1 |
| Genbank accession: | NM_002398 |
| Immunogen: | MEIS1 (NP_002389, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI |
| Protein accession: | NP_002389 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | MEIS1 intronic risk haplotype associated with restless legs syndrome affects its mRNA and protein expression levels.Xiong L, Catoire H, Dion P, Gaspar C, Lafreniere RG, Girard SL, Levchenko A, Riviere JB, Fiori L, St-Onge J, Bachand I, Thibodeau P, Allen R, Earley C, Turecki G, Montplaisir J, Rouleau GA. Hum Mol Genet. 2009 Mar 15;18(6):1065-74. Epub 2009 Jan 6. |