Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MEFV polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MEFV polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004210-A01 |
| Product name: | MEFV polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MEFV. |
| Gene id: | 4210 |
| Gene name: | MEFV |
| Gene alias: | FMF|MEF|MGC126560|MGC126586|TRIM20 |
| Gene description: | Mediterranean fever |
| Genbank accession: | NM_000243 |
| Immunogen: | MEFV (NP_000234, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL |
| Protein accession: | NP_000234 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The effect of colchicine on pyrin and pyrin interacting proteins.Taskiran EZ, Cetinkaya A, Balci-Peynircioglu B, Akkaya YZ, Yilmaz E. J Cell Biochem. 2012 Jun 21. doi: 10.1002/jcb.24231. |