| Brand: | Abnova |
| Reference: | H00004209-M04 |
| Product name: | MEF2D monoclonal antibody (M04), clone 3F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MEF2D. |
| Clone: | 3F8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4209 |
| Gene name: | MEF2D |
| Gene alias: | DKFZp686I1536 |
| Gene description: | myocyte enhancer factor 2D |
| Genbank accession: | NM_005920 |
| Immunogen: | MEF2D (NP_005911.1, 256 a.a. ~ 351 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS |
| Protein accession: | NP_005911.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MEF2D monoclonal antibody (M04), clone 3F8 Western Blot analysis of MEF2D expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |