No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00004205-M07 |
| Product name: | MEF2A monoclonal antibody (M07), clone 1C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MEF2A. |
| Clone: | 1C4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4205 |
| Gene name: | MEF2A |
| Gene alias: | ADCAD1|RSRFC4|RSRFC9 |
| Gene description: | myocyte enhancer factor 2A |
| Genbank accession: | BC013437 |
| Immunogen: | MEF2A (AAH13437, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA |
| Protein accession: | AAH13437 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | MEF2A monoclonal antibody (M07), clone 1C4. Western Blot analysis of MEF2A expression in human lung cancer. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |